PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 301aa    MW: 34259.1 Da    PI: 6.6191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0613genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.1e-192471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
      Gh_D02G0613 24 RGPWTVEEDFKLINYIAIHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding51.42.5e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_D02G0613  77 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 120
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7871971IPR017930Myb domain
SuperFamilySSF466893.33E-3121118IPR009057Homeodomain-like
SMARTSM007171.1E-152373IPR001005SANT/Myb domain
PfamPF002491.0E-162471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-232578IPR009057Homeodomain-like
CDDcd001673.56E-132671No hitNo description
PROSITE profilePS5129423.50272126IPR017930Myb domain
SMARTSM007171.3E-1476124IPR001005SANT/Myb domain
PfamPF002495.0E-1577120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2379125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDGKKRGCTG NVQSEEDHEM DLIRGPWTVE EDFKLINYIA IHGEGRWNSL ARCAGLKRTG  60
KSCRLRWLNY LRPDIRRGNI TLEEQLLILE LHSRWGNRWS KIAQHLPGRT DNEIKNYWRT  120
RVQKHAKQLK CDVNSKQFKD TMRYLWMPRL VERIQAAAGS TTTTTTTTAV VPSASVMGKD  180
FSTHVTPSYT SENSSTATAA SSESFEAQVS PVSDLTNCYN NGFQVTNNNN PNPDYNFQAC  240
SSQVDYYEYS LSAANYYNHG DGGCLDLQTN NYPMLDGADL SDNLLNAEDF LFLQQQFNFN  300
M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26211244106B-MYB
1gv2_A7e-2621118197MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482236.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE16e-89MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2SBZ90.0A0A0D2SBZ9_G
STRINGPOPTR_0010s15970.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.14e-87myb domain protein 78